PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI12G04390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 462aa    MW: 50587.6 Da    PI: 4.2822
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI12G04390.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS92.28e-291753063132
             GRAS   3 elLlecAeavssgdlelaqalLarlsel.aspdgd.......pmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                      +lLl+ A av++gd+  a+a+++rl +l a  +g+       p+  la yf+++L+ r+++      +a p+s+ ++     +  a+++++e++
  ORUFI12G04390.1 175 DLLLAGAMAVDAGDAVHASAIMSRLDDLlADIAGRrsceatsPVDHLAYYFARGLKLRISG------AATPASSPPPPAANWSSPAYRMLQELT 262
                      689999*******************998766666456666679******************......3344444444445667789******** PP

             GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaL 132
                      P++kf+h+taNqaIlea++ +  vH++Df++++G+QW +L+ +L
  ORUFI12G04390.1 263 PFVKFAHFTANQAILEATADDLDVHVVDFNVGEGVQWSSLMLKL 306
                      *****************************************776 PP

2GRAS43.64.7e-14308459227373
             GRAS 227 vLklvkslsPkvvvvveqeadh.nse..........sFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerh 309
                      +L ++  l+Pk+v+++e e+++ +++          +F e f++a+ +++a+++s+++ l + ++e ++++ + +g+e   vv  + ++ + r 
  ORUFI12G04390.1 308 LLGTITILQPKLVILIEDELSRiSKNppspslaappPFPEFFSDAVAHFTAVMESTASCLVSYDDE-AWLSLRRVGEE---VVGPRVEDAVGRY 397
                      6899999************999544489****************************8776554433.33332223433...3445555555566 PP

             GRAS 310 etlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve.eesgslvlgWkdrpLvsvSaW 373
                       +l+   +++e  G+++ ++s + ++q k+l   ++  g+ v  +e+g l l+Wk+rpL+svS W
  ORUFI12G04390.1 398 GSLAGGAQMME--GLRAREVSGFSVAQGKMLAGLFG-GGFGVVhQEKGRLALCWKSRPLISVSLW 459
                      66677778876..***********************.67876638899999************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098518.766147462IPR005202Transcription factor GRAS
PfamPF035142.8E-26175306IPR005202Transcription factor GRAS
PfamPF035141.6E-11308459IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
METMSYPCSL LIPFSTQFEE ISSSSLLLWS PQAEENPHEN ANMYEFDADH SHDQIHQDHQ  60
FLDMMVIQES ANEFDGNHSH DQIHQDHEFL ETMVIQESAN EFDGDHSHDQ IHQDHEFLEM  120
MAIQESANDL LQLQDDFSVP NADPLAASFE FDERLAVAGH ENGNVVATQE ESAGDLLLAG  180
AMAVDAGDAV HASAIMSRLD DLLADIAGRR SCEATSPVDH LAYYFARGLK LRISGAATPA  240
SSPPPPAANW SSPAYRMLQE LTPFVKFAHF TANQAILEAT ADDLDVHVVD FNVGEGVQWS  300
SLMLKLLLLG TITILQPKLV ILIEDELSRI SKNPPSPSLA APPPFPEFFS DAVAHFTAVM  360
ESTASCLVSY DDEAWLSLRR VGEEVVGPRV EDAVGRYGSL AGGAQMMEGL RAREVSGFSV  420
AQGKMLAGLF GGGFGVVHQE KGRLALCWKS RPLISVSLWC PK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-1420430624131GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL7139060.0AL713906.3 Oryza sativa chromosome 12, . BAC OJ1587_D05 of library Monsanto from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619150.11e-115PREDICTED: uncharacterized protein LOC4351577
TrEMBLA0A0E0RE570.0A0A0E0RE57_ORYRU; Uncharacterized protein
TrEMBLQ2QXC10.0Q2QXC1_ORYSJ; GRAS family transcription factor containing protein
STRINGLOC_Os12g06540.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP171141111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50650.12e-12GRAS family protein